site stats

Cyhr1

WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% …

CYHR1: Target/Biomarker Introduction, products summarized …

WebCYHR1 cysteine and histidine rich 1 Location: Also known as: KIAA0496, MGC13010, CHRP Ensembl: ENSG00000187954 NCBI Entrez Gene: 50626 Perturbation Effects … WebID: CYHR1_HUMAN DESCRIPTION: RecName: Full=Cysteine and histidine-rich protein 1; SUBUNIT: Interacts with LGALS3 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cytoplasm, perinuclear region (By similarity). Note=Shows a prominent perinuclear and cytoplasmic localization (By similarity). SIMILARITY: Belongs to the … dynamic blocks free download https://familysafesolutions.com

CYHR1 - nematode.wi.mit.edu

WebCYHR1 CRISPR Knockout and Activation Plasmids (m) designed to edit, knockdown or upregulate mouse CYHR1 gene expression. Choose a Store Santa cruz biotechnology. Santa Cruz Animal Health. Choose a Language English Français 日本語 中文 한글 ... WebThis target displays homology in the following species: Cow: 93%; Human: 100%; Mouse: 100%; Rat: 100% Target Information CYHR1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include nucleoplasm; zinc ion binding. For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization. Webanti-CYHR1 antibody (Cysteine/histidine-Rich 1) AA 51-100. anti-CYHR1 antibody (Cysteine/histidine-Rich 1) Middle Region. Browse Primary Antibodies and Browse … crystal sugar drayton

BRHR - What does BRHR stand for? The Free Dictionary

Category:As a Novel Prognostic Marker, Cysteine/histidine-rich 1 …

Tags:Cyhr1

Cyhr1

Gene - CYHR1

WebCYHR1 Gene - Somatic Mutations in Cancer Actionability v8 is now available for download Gene GRCh38 · COSMIC v97 Gene view The gene view histogram is a graphical view of … WebMeaning. CVHR. Cyclic Variation of Heart Rate (cardiology) CVHR. Citizens' Voice for Health Rights (Canada) CVHR. Cardiovasculaire, Hémostase, Respiration (French: …

Cyhr1

Did you know?

WebPrEST Antigen CYHR1; Blocking agent and positive assay control using corresponding antibodies. Bulk and Prepack available at Sigmaaldrich.com. US EN. Applications Products Services Support. APREST89884; All Photos (1) APREST89884. PrEST Antigen CYHR1. WebItem Human Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit; Company MyBioSource.com; Price Pricing Info Supplier Page View Company Product Page; Catalog Number MBS7219175; Quantity 96 Strip Wells; Applications ELISA; Reactivity Human; Detection Target Cysteine and histidine rich protein 1 (CYHR1) Molecular Weight 22,766 …

WebJul 1, 2004 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1 gene ... WebMar 21, 2024 · lnc-CYHR1-1 is an RNA Gene, and is affiliated with the lncRNA class. Additional gene information for lnc-CYHR1-1 Gene Search for lnc-CYHR1-1 at DataMed Search for lnc-CYHR1-1 at HumanCyc

WebCYHR1. 1110031M01Rik, AU042374, Chrp. cysteine and histidine rich 1. GO Process (0) GO Function (1) GO Component (3) Gene Ontology Molecular Function. protein binding . Gene Ontology Cellular Component. cytoplasm ; nuclear envelope ; nucleoplasm . WebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ...

WebEach montage below shows randomly selected individual cell images for the same target gene separated by sgRNA, along with an example montage of cells expressing a non-targeting negative control sgRNA at the bottom. sgRNA labels in the montages correspond to the numbered sgRNA sequences in the gene info table above.

WebThe deduced 311-amino acid protein has an N-terminal cysteine- and histidine-rich domain that shares similarity with metal-binding zinc finger domains in other proteins. Northern … dynamic blocks in revitWebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and … crystal sugar milling companyWebThis locus represents naturally occurring read-through transcription between the neighboring LOC84773 and cysteine and histidine rich 1 (CYHR1). It encodes a fusion protein that shares sequence identity with proteins encoded by both independent genes. [provided by RefSeq, Feb 2024] TMEM276-ZFTRAF1 TMEM276-ZFTRAF1 readthrough [ (human)] crystal sugar moorheadWebCYHR1 in human cancer is unknown.16–19 To evaluate the role and significance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the dynamic blue chip balanced fund factsWebThe estimate of $40 million for the total cost of this program is based on an assumed 100 researchers leading 400 short courses for 6,000 other individuals.(12) These funds … crystal sugar crookston mnWebPharos : Target Details - CYHR1 Jump to section: close Descriptive Data Protein Summary Protein Classes IDG Development Level Summary Expression Data Protein Sequence … crystal sugar creamer setWebCYHR1 Alias symbols CHRP, KIAA0496, MGC13010 %HI 61.63(Read more about the DECIPHER Haploinsufficiency Index) pLI 0.49(Read more about gnomAD pLI score) LOEUF 0.53(Read more about gnomAD LOEUF score) Cytoband 8q24.3 Genomic Coordinates. GRCh37/hg19: chr8:145674965-145691084: NCBI Ensembl UCSC: crystal sugar grand forks nd